PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART04G30090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YC
Protein Properties Length: 125aa    MW: 13251.1 Da    PI: 9.1825
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART04G30090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC83.91.9e-26541163799
            NF-YC  37 kmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivprd 99 
                      +mis eaPv++skacelfi elt r+w  + e krrt++k d+aaav++td fdflvd+v  d
  OBART04G30090.1  54 RMISGEAPVVFSKACELFIAELTRRAWAATLEGKRRTVHKEDVAAAVQNTDLFDFLVDVVTAD 116
                      8**********************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.27E-2418109IPR009072Histone-fold
Gene3DG3DSA:1.10.20.108.3E-3119101IPR009072Histone-fold
PfamPF008083.0E-1252100IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MRQARPYSAM FAGGVSARTG PHALPLARIK KIMKRSAGDS SVVDGGGGGG GGTRMISGEA  60
PVVFSKACEL FIAELTRRAW AATLEGKRRT VHKEDVAAAV QNTDLFDFLV DVVTADLGDD  120
HTDYK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_C3e-252211340117HapE
4g92_C3e-252211340117HapE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880470.0AB288047.1 Oryza sativa Japonica Group OsHAP5G gene for HAP5 subunit of HAP complex, complete cds.
GenBankAL6066410.0AL606641.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0032F06, complete sequence.
GenBankAP0149600.0AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635297.11e-86PREDICTED: nuclear transcription factor Y subunit C-2-like
SwissprotQ8LCG73e-31NFYC2_ARATH; Nuclear transcription factor Y subunit C-2
SwissprotQ9ZVL36e-31NFYC3_ARATH; Nuclear transcription factor Y subunit C-3
TrEMBLA0A0D3G1W13e-87A0A0D3G1W1_9ORYZ; Uncharacterized protein
TrEMBLI1PR203e-87I1PR20_ORYGL; Uncharacterized protein
STRINGORGLA04G0263900.18e-87(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP116583339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56170.27e-31nuclear factor Y, subunit C2